HBEGF Peptide - N-terminal region

Artikelnummer: BYT-ORB2004296
Artikelname: HBEGF Peptide - N-terminal region
Artikelnummer: BYT-ORB2004296
Hersteller Artikelnummer: orb2004296
Alternativnummer: BYT-ORB2004296-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
Alternative Synonym: DTR, DTS, DTSF, HEGFL
HBEGF Peptide - N-terminal region
NCBI: 001936
UniProt: Q99075
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: Synthetic peptide located within the following region: FLAAVLSALVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKV
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with HBEGF Rabbit Polyclonal Antibody (orb579406). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings