HBEGF Peptide - N-terminal region

Product Overview

• Article Name: HBEGF Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB2004296
• Supplier Catalog Number: orb2004296
• Alternative Catalog Number: BYT-ORB2004296-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: DTR, DTS, DTSF, HEGFL

Product Description

HBEGF Peptide - N-terminal region

Product Properties

• NCBI: 001936
• UniProt: Q99075
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: FLAAVLSALVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKV

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with HBEGF Rabbit Polyclonal Antibody (orb579406). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings