SPPL2B Peptide - N-terminal region

Artikelnummer: BYT-ORB2004298
Artikelname: SPPL2B Peptide - N-terminal region
Artikelnummer: BYT-ORB2004298
Hersteller Artikelnummer: orb2004298
Alternativnummer: BYT-ORB2004298-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
Alternative Synonym: IMP-4, IMP4, PSH4, PSL1
SPPL2B Peptide - N-terminal region
NCBI: 694533
UniProt: Q8TCT7
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: Synthetic peptide located within the following region: AHLPHDLSKASFLQLRNWTASLLCSAADLPARGFSNQIPLVARGNCTFYE
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with SPPL2B Rabbit Polyclonal Antibody (orb325199). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings