SPPL2B Peptide - N-terminal region

Product Overview

• Article Name: SPPL2B Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB2004298
• Supplier Catalog Number: orb2004298
• Alternative Catalog Number: BYT-ORB2004298-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: IMP-4, IMP4, PSH4, PSL1

Product Description

SPPL2B Peptide - N-terminal region

Product Properties

• NCBI: 694533
• UniProt: Q8TCT7
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: AHLPHDLSKASFLQLRNWTASLLCSAADLPARGFSNQIPLVARGNCTFYE

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with SPPL2B Rabbit Polyclonal Antibody (orb325199). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings