OCA2 Peptide - C-terminal region

Produktübersicht

• Artikelname: OCA2 Peptide - C-terminal region
• Artikelnummer: BYT-ORB2004299
• Hersteller Artikelnummer: orb2004299
• Alternativnummer: BYT-ORB2004299-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB
• Alternative Synonym: BEY, BEY1, BEY2, BOCA, D15S12, EYCL, EYCL2, EYCL3, HCL3, P, PED, SHEP1

Produktbeschreibung

OCA2 Peptide - C-terminal region

Produkteigenschaften

• NCBI: 000266
• UniProt: Q04671
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: CLIAAVLSAFLDNVTTMLLFTPVTIRLCEVLNLDPRQVLIAEVIFTNIGG

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with OCA2 Rabbit Polyclonal Antibody (orb579108). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings