OCA2 Peptide - C-terminal region

Product Overview

• Article Name: OCA2 Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2004299
• Supplier Catalog Number: orb2004299
• Alternative Catalog Number: BYT-ORB2004299-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: BEY, BEY1, BEY2, BOCA, D15S12, EYCL, EYCL2, EYCL3, HCL3, P, PED, SHEP1

Product Description

OCA2 Peptide - C-terminal region

Product Properties

• NCBI: 000266
• UniProt: Q04671
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: CLIAAVLSAFLDNVTTMLLFTPVTIRLCEVLNLDPRQVLIAEVIFTNIGG

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with OCA2 Rabbit Polyclonal Antibody (orb579108). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings