SLC22A14 Peptide - N-terminal region

Produktübersicht

• Artikelname: SLC22A14 Peptide - N-terminal region
• Artikelnummer: BYT-ORB2004303
• Hersteller Artikelnummer: orb2004303
• Alternativnummer: BYT-ORB2004303-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB
• Alternative Synonym: OCTL2, OCTL4, ORCTL4

Produktbeschreibung

SLC22A14 Peptide - N-terminal region

Produkteigenschaften

• NCBI: 004794
• UniProt: Q9Y267
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: AEQLNLTIPQAPNGSFLTCFMYLPVPWNLDSIIQFGLNDTDTCQDGWIYP

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with SLC22A14 Rabbit Polyclonal Antibody (orb578977). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings