SLC22A14 Peptide - N-terminal region

Product Overview

• Article Name: SLC22A14 Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB2004303
• Supplier Catalog Number: orb2004303
• Alternative Catalog Number: BYT-ORB2004303-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: OCTL2, OCTL4, ORCTL4

Product Description

SLC22A14 Peptide - N-terminal region

Product Properties

• NCBI: 004794
• UniProt: Q9Y267
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: AEQLNLTIPQAPNGSFLTCFMYLPVPWNLDSIIQFGLNDTDTCQDGWIYP

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with SLC22A14 Rabbit Polyclonal Antibody (orb578977). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings