TRIM49C Peptide - N-terminal region

Artikelnummer: BYT-ORB2004306
Artikelname: TRIM49C Peptide - N-terminal region
Artikelnummer: BYT-ORB2004306
Hersteller Artikelnummer: orb2004306
Alternativnummer: BYT-ORB2004306-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
Alternative Synonym: TRIM49L2
TRIM49C Peptide - N-terminal region
NCBI: 001182163
UniProt: P0CI26
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: Synthetic peptide located within the following region: QCSECTKSTEQINLKTNIHLKKMASLARKVSLWLFLSSEEQMCGTHRETK
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with TRIM49C Rabbit Polyclonal Antibody (orb578853). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings