TRIM49C Peptide - N-terminal region

Product Overview

• Article Name: TRIM49C Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB2004306
• Supplier Catalog Number: orb2004306
• Alternative Catalog Number: BYT-ORB2004306-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: TRIM49L2

Product Description

TRIM49C Peptide - N-terminal region

Product Properties

• NCBI: 001182163
• UniProt: P0CI26
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: QCSECTKSTEQINLKTNIHLKKMASLARKVSLWLFLSSEEQMCGTHRETK

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with TRIM49C Rabbit Polyclonal Antibody (orb578853). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings