RBBP6 Peptide - N-terminal region

Artikelnummer: BYT-ORB2004310
Artikelname: RBBP6 Peptide - N-terminal region
Artikelnummer: BYT-ORB2004310
Hersteller Artikelnummer: orb2004310
Alternativnummer: BYT-ORB2004310-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
Alternative Synonym: MY038, P2P-R, PACT, RBQ-1, SNAMA
RBBP6 Peptide - N-terminal region
NCBI: 116015
UniProt: Q7Z6E9
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: Synthetic peptide located within the following region: NYDTVTFDGLHISLCDLKKQIMGREKLKAADCDLQITNAQTKEEYTDDNA
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with RBBP6 Rabbit Polyclonal Antibody (orb578709). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings