RBBP6 Peptide - N-terminal region

Product Overview

• Article Name: RBBP6 Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB2004310
• Supplier Catalog Number: orb2004310
• Alternative Catalog Number: BYT-ORB2004310-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: MY038, P2P-R, PACT, RBQ-1, SNAMA

Product Description

RBBP6 Peptide - N-terminal region

Product Properties

• NCBI: 116015
• UniProt: Q7Z6E9
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: NYDTVTFDGLHISLCDLKKQIMGREKLKAADCDLQITNAQTKEEYTDDNA

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with RBBP6 Rabbit Polyclonal Antibody (orb578709). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings