Pard6b Peptide - N-terminal region

Artikelnummer: BYT-ORB2004313
Artikelname: Pard6b Peptide - N-terminal region
Artikelnummer: BYT-ORB2004313
Hersteller Artikelnummer: orb2004313
Alternativnummer: BYT-ORB2004313-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
Alternative Synonym: AV025615, Par6b
Pard6b Peptide - N-terminal region
NCBI: 067384
UniProt: Q9JK83
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: Synthetic peptide located within the following region: SKFGAEFRRFSLERSKPGKFEEFYGLLQHVHKIPNVDVLVGYADIHGDLL
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with Pard6b Rabbit Polyclonal Antibody (orb578646). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings