Pard6b Peptide - N-terminal region

Product Overview

• Article Name: Pard6b Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB2004313
• Supplier Catalog Number: orb2004313
• Alternative Catalog Number: BYT-ORB2004313-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: AV025615, Par6b

Product Description

Pard6b Peptide - N-terminal region

Product Properties

• NCBI: 067384
• UniProt: Q9JK83
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: SKFGAEFRRFSLERSKPGKFEEFYGLLQHVHKIPNVDVLVGYADIHGDLL

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with Pard6b Rabbit Polyclonal Antibody (orb578646). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings