ACSL6 Peptide - C-terminal region

Produktübersicht

• Artikelname: ACSL6 Peptide - C-terminal region
• Artikelnummer: BYT-ORB2004318
• Hersteller Artikelnummer: orb2004318
• Alternativnummer: BYT-ORB2004318-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB
• Alternative Synonym: ACS2, FACL6, LACS 6, LACS2, LACS5

Produktbeschreibung

ACSL6 Peptide - C-terminal region

Produkteigenschaften

• NCBI: 056071
• UniProt: Q9UKU0
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: SGLHSFEQVKAIHIHSDMFSVQNGLLTPTLKAKRPELREYFKKQIEELYS

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with ACSL6 Rabbit Polyclonal Antibody (orb578246). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings