ACSL6 Peptide - C-terminal region

Catalog Number: BYT-ORB2004318
Article Name: ACSL6 Peptide - C-terminal region
Biozol Catalog Number: BYT-ORB2004318
Supplier Catalog Number: orb2004318
Alternative Catalog Number: BYT-ORB2004318-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
Alternative Names: ACS2, FACL6, LACS 6, LACS2, LACS5
ACSL6 Peptide - C-terminal region
NCBI: 056071
UniProt: Q9UKU0
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: Synthetic peptide located within the following region: SGLHSFEQVKAIHIHSDMFSVQNGLLTPTLKAKRPELREYFKKQIEELYS
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with ACSL6 Rabbit Polyclonal Antibody (orb578246). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings