Map2k1 Peptide - C-terminal region

Artikelnummer: BYT-ORB2007929
Artikelname: Map2k1 Peptide - C-terminal region
Artikelnummer: BYT-ORB2007929
Hersteller Artikelnummer: orb2007929
Alternativnummer: BYT-ORB2007929-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
Alternative Synonym: MAPKK1, MEKK1, Mek1, Prkmk1
Map2k1 Peptide - C-terminal region
Molekulargewicht: 43kDa
NCBI: 032953
UniProt: Q9JJE1
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: LIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLNQPSTPTHAA
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with Map2k1 Rabbit Polyclonal Antibody (orb584883). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings