Map2k1 Peptide - C-terminal region

Catalog Number: BYT-ORB2007929
Article Name: Map2k1 Peptide - C-terminal region
Biozol Catalog Number: BYT-ORB2007929
Supplier Catalog Number: orb2007929
Alternative Catalog Number: BYT-ORB2007929-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
Alternative Names: MAPKK1, MEKK1, Mek1, Prkmk1
Map2k1 Peptide - C-terminal region
Molecular Weight: 43kDa
NCBI: 032953
UniProt: Q9JJE1
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: LIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLNQPSTPTHAA
Application Notes: This is a synthetic peptide designed for use in combination with Map2k1 Rabbit Polyclonal Antibody (orb584883). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.