RPS3 Peptide - middle region

Artikelnummer: BYT-ORB2007956
Artikelname: RPS3 Peptide - middle region
Artikelnummer: BYT-ORB2007956
Hersteller Artikelnummer: orb2007956
Alternativnummer: BYT-ORB2007956-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
Alternative Synonym: FLJ26283, FLJ27450, MGC87870, S3
RPS3 Peptide - middle region
Molekulargewicht: 27kDa
NCBI: 000996
UniProt: P23396
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: RRACYGVLRFIMESGAKGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPVN
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with RPS3 Rabbit Polyclonal Antibody (orb585742). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings