RPS3 Peptide - middle region

Catalog Number: BYT-ORB2007956
Article Name: RPS3 Peptide - middle region
Biozol Catalog Number: BYT-ORB2007956
Supplier Catalog Number: orb2007956
Alternative Catalog Number: BYT-ORB2007956-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
Alternative Names: FLJ26283, FLJ27450, MGC87870, S3
RPS3 Peptide - middle region
Molecular Weight: 27kDa
NCBI: 000996
UniProt: P23396
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: RRACYGVLRFIMESGAKGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPVN
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with RPS3 Rabbit Polyclonal Antibody (orb585742). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings