PKM2 Peptide - middle region

Artikelnummer: BYT-ORB2009512
Artikelname: PKM2 Peptide - middle region
Artikelnummer: BYT-ORB2009512
Hersteller Artikelnummer: orb2009512
Alternativnummer: BYT-ORB2009512-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
Alternative Synonym: CTHBP, MGC3932, OIP3, PK3, PKM, TCB, THBP1, PKM2
PKM2 Peptide - middle region
Molekulargewicht: 58kDa
NCBI: 002645
UniProt: P11980
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: HLQLFEELRRLAPITSDPTEATAVGAVEASFKCCSGAIIVLTKSGRSAHQ
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with PKM2 Rabbit Polyclonal Antibody (orb583715). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings