PKM2 Peptide - middle region

Product Overview

• Article Name: PKM2 Peptide - middle region
• Biozol Catalog Number: BYT-ORB2009512
• Supplier Catalog Number: orb2009512
• Alternative Catalog Number: BYT-ORB2009512-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: CTHBP, MGC3932, OIP3, PK3, PKM, TCB, THBP1, PKM2

Product Description

PKM2 Peptide - middle region

Product Properties

• Molecular Weight: 58kDa
• NCBI: 002645
• UniProt: P11980
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: HLQLFEELRRLAPITSDPTEATAVGAVEASFKCCSGAIIVLTKSGRSAHQ

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with PKM2 Rabbit Polyclonal Antibody (orb583715). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings