Pitx1 Peptide - middle region

Artikelnummer: BYT-ORB2009520
Artikelname: Pitx1 Peptide - middle region
Artikelnummer: BYT-ORB2009520
Hersteller Artikelnummer: orb2009520
Alternativnummer: BYT-ORB2009520-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
Alternative Synonym: Bft
Pitx1 Peptide - middle region
Molekulargewicht: 34kDa
NCBI: 446076
UniProt: Q99NA7
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: LCKGGYVPQFSGLVQPYEDVYAAAGYSYNNWAAKSLAPAPLSTKSFTFFN
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with Pitx1 Rabbit Polyclonal Antibody (orb574472). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings