Pitx1 Peptide - middle region

Catalog Number: BYT-ORB2009520
Article Name: Pitx1 Peptide - middle region
Biozol Catalog Number: BYT-ORB2009520
Supplier Catalog Number: orb2009520
Alternative Catalog Number: BYT-ORB2009520-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
Alternative Names: Bft
Pitx1 Peptide - middle region
Molecular Weight: 34kDa
NCBI: 446076
UniProt: Q99NA7
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: LCKGGYVPQFSGLVQPYEDVYAAAGYSYNNWAAKSLAPAPLSTKSFTFFN
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with Pitx1 Rabbit Polyclonal Antibody (orb574472). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings