PINX1 Peptide - middle region

Artikelnummer: BYT-ORB2009523
Artikelname: PINX1 Peptide - middle region
Artikelnummer: BYT-ORB2009523
Hersteller Artikelnummer: orb2009523
Alternativnummer: BYT-ORB2009523-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
Alternative Synonym: FLJ20565, LPTL, LPTS, MGC8850
PINX1 Peptide - middle region
Molekulargewicht: 37kDa
NCBI: 060354
UniProt: Q96BK5
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: EKKSFSLEEKSKISKNRVHYMKFTKGKDLSSRSKTDLDCIFGKRQSKKTP
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with PINX1 Rabbit Polyclonal Antibody (orb330912). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings