PINX1 Peptide - middle region

Catalog Number: BYT-ORB2009523
Article Name: PINX1 Peptide - middle region
Biozol Catalog Number: BYT-ORB2009523
Supplier Catalog Number: orb2009523
Alternative Catalog Number: BYT-ORB2009523-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
Alternative Names: FLJ20565, LPTL, LPTS, MGC8850
PINX1 Peptide - middle region
Molecular Weight: 37kDa
NCBI: 060354
UniProt: Q96BK5
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: EKKSFSLEEKSKISKNRVHYMKFTKGKDLSSRSKTDLDCIFGKRQSKKTP
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with PINX1 Rabbit Polyclonal Antibody (orb330912). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings