PIGX Peptide - C-terminal region

Artikelnummer: BYT-ORB2009528
Artikelname: PIGX Peptide - C-terminal region
Artikelnummer: BYT-ORB2009528
Hersteller Artikelnummer: orb2009528
Alternativnummer: BYT-ORB2009528-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
Alternative Synonym: FLJ20522
PIGX Peptide - C-terminal region
Molekulargewicht: 25kDa
NCBI: 060331
UniProt: A8MSL3
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: AAPCALENEDICQWNKMKYKSVYKNVILQVPVGLTVHTSLVCSVTLLITI
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with PIGX Rabbit Polyclonal Antibody (orb584827). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings