PIGX Peptide - C-terminal region

Catalog Number: BYT-ORB2009528
Article Name: PIGX Peptide - C-terminal region
Biozol Catalog Number: BYT-ORB2009528
Supplier Catalog Number: orb2009528
Alternative Catalog Number: BYT-ORB2009528-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
Alternative Names: FLJ20522
PIGX Peptide - C-terminal region
Molecular Weight: 25kDa
NCBI: 060331
UniProt: A8MSL3
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: AAPCALENEDICQWNKMKYKSVYKNVILQVPVGLTVHTSLVCSVTLLITI
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with PIGX Rabbit Polyclonal Antibody (orb584827). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings