PIGC Peptide - C-terminal region

Artikelnummer: BYT-ORB2009533
Artikelname: PIGC Peptide - C-terminal region
Artikelnummer: BYT-ORB2009533
Hersteller Artikelnummer: orb2009533
Alternativnummer: BYT-ORB2009533-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
Alternative Synonym: GPI2, MGC2049
PIGC Peptide - C-terminal region
Molekulargewicht: 33kDa
NCBI: 002633
UniProt: Q92535
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: AVGAVLFALLLMSISCLCPFYLIRLQLFKENIHGPWDEAEIKEDLSRFLS
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with PIGC Rabbit Polyclonal Antibody (orb326371). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings