PIGC Peptide - C-terminal region

Catalog Number: BYT-ORB2009533
Article Name: PIGC Peptide - C-terminal region
Biozol Catalog Number: BYT-ORB2009533
Supplier Catalog Number: orb2009533
Alternative Catalog Number: BYT-ORB2009533-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
Alternative Names: GPI2, MGC2049
PIGC Peptide - C-terminal region
Molecular Weight: 33kDa
NCBI: 002633
UniProt: Q92535
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: AVGAVLFALLLMSISCLCPFYLIRLQLFKENIHGPWDEAEIKEDLSRFLS
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with PIGC Rabbit Polyclonal Antibody (orb326371). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings