PIBF1 Peptide - C-terminal region

Artikelnummer: BYT-ORB2009534
Artikelname: PIBF1 Peptide - C-terminal region
Artikelnummer: BYT-ORB2009534
Hersteller Artikelnummer: orb2009534
Alternativnummer: BYT-ORB2009534-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
Alternative Synonym: C13orf24, KIAA1008, PIBF, RP11-505F3.1
PIBF1 Peptide - C-terminal region
Molekulargewicht: 90kDa
NCBI: 006337
UniProt: Q8WXW3
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: RKDQVTQLSQELDRANSLLNQTQQPYRYLIESVRQRDSKIDSLTESIAQL
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with PIBF1 Rabbit Polyclonal Antibody (orb581593). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings