PIBF1 Peptide - C-terminal region

Product Overview

• Article Name: PIBF1 Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2009534
• Supplier Catalog Number: orb2009534
• Alternative Catalog Number: BYT-ORB2009534-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: C13orf24, KIAA1008, PIBF, RP11-505F3.1

Product Description

PIBF1 Peptide - C-terminal region

Product Properties

• Molecular Weight: 90kDa
• NCBI: 006337
• UniProt: Q8WXW3
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: RKDQVTQLSQELDRANSLLNQTQQPYRYLIESVRQRDSKIDSLTESIAQL

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with PIBF1 Rabbit Polyclonal Antibody (orb581593). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings