PHYHIPL Peptide - C-terminal region

Artikelnummer: BYT-ORB2009539
Artikelname: PHYHIPL Peptide - C-terminal region
Artikelnummer: BYT-ORB2009539
Hersteller Artikelnummer: orb2009539
Alternativnummer: BYT-ORB2009539-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
Alternative Synonym: KIAA1796
PHYHIPL Peptide - C-terminal region
Molekulargewicht: 19kDa
NCBI: 115815
UniProt: Q96FC7
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: ESVDEYQFVERLLPATRIPDPPKHEHYPTPSGWQPPRDPPPNLPYFVRRS
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with PHYHIPL Rabbit Polyclonal Antibody (orb326319). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings