PHYHIPL Peptide - C-terminal region

Catalog Number: BYT-ORB2009539
Article Name: PHYHIPL Peptide - C-terminal region
Biozol Catalog Number: BYT-ORB2009539
Supplier Catalog Number: orb2009539
Alternative Catalog Number: BYT-ORB2009539-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
Alternative Names: KIAA1796
PHYHIPL Peptide - C-terminal region
Molecular Weight: 19kDa
NCBI: 115815
UniProt: Q96FC7
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: ESVDEYQFVERLLPATRIPDPPKHEHYPTPSGWQPPRDPPPNLPYFVRRS
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with PHYHIPL Rabbit Polyclonal Antibody (orb326319). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings