PARG Peptide - C-terminal region

Artikelnummer: BYT-ORB2009614
Artikelname: PARG Peptide - C-terminal region
Artikelnummer: BYT-ORB2009614
Hersteller Artikelnummer: orb2009614
Alternativnummer: BYT-ORB2009614-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
Alternative Synonym: FLJ60456, PARG99
PARG Peptide - C-terminal region
Molekulargewicht: 107kDa
NCBI: 003622
UniProt: Q86W56
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: LFTEVLDHNECLIITGTEQYSEYTGYAETYRWSRSHEDGSERDDWQRRCT
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with PARG Rabbit Polyclonal Antibody (orb585690). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings