PARG Peptide - C-terminal region

Product Overview

• Article Name: PARG Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2009614
• Supplier Catalog Number: orb2009614
• Alternative Catalog Number: BYT-ORB2009614-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: FLJ60456, PARG99

Product Description

PARG Peptide - C-terminal region

Product Properties

• Molecular Weight: 107kDa
• NCBI: 003622
• UniProt: Q86W56
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: LFTEVLDHNECLIITGTEQYSEYTGYAETYRWSRSHEDGSERDDWQRRCT

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with PARG Rabbit Polyclonal Antibody (orb585690). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings