P2ry1 Peptide - middle region

Artikelnummer: BYT-ORB2009631
Artikelname: P2ry1 Peptide - middle region
Artikelnummer: BYT-ORB2009631
Hersteller Artikelnummer: orb2009631
Alternativnummer: BYT-ORB2009631-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
Alternative Synonym: P2y, P2y1
P2ry1 Peptide - middle region
Molekulargewicht: 42kDa
NCBI: 036932
UniProt: P49651
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: VVAISPILFYSGTGIRKNKTVTCYDSTSDEYLRSYFIYSMCTTVAMFCIP
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with P2ry1 Rabbit Polyclonal Antibody (orb330631). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings