P2ry1 Peptide - middle region

Catalog Number: BYT-ORB2009631
Article Name: P2ry1 Peptide - middle region
Biozol Catalog Number: BYT-ORB2009631
Supplier Catalog Number: orb2009631
Alternative Catalog Number: BYT-ORB2009631-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
Alternative Names: P2y, P2y1
P2ry1 Peptide - middle region
Molecular Weight: 42kDa
NCBI: 036932
UniProt: P49651
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: VVAISPILFYSGTGIRKNKTVTCYDSTSDEYLRSYFIYSMCTTVAMFCIP
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with P2ry1 Rabbit Polyclonal Antibody (orb330631). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings