OTUB2 Peptide - middle region

Artikelnummer: BYT-ORB2009640
Artikelname: OTUB2 Peptide - middle region
Artikelnummer: BYT-ORB2009640
Hersteller Artikelnummer: orb2009640
Alternativnummer: BYT-ORB2009640-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
Alternative Synonym: C14orf137, FLJ21916, MGC3102, OTB2, OTU2
OTUB2 Peptide - middle region
Molekulargewicht: 27kDa
NCBI: 075601
UniProt: Q96DC9
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: EEHKFRNFFNAFYSVVELVEKDGSVSSLLKVFNDQSASDHIVQFLRLLTS
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with OTUB2 Rabbit Polyclonal Antibody (orb331030). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings