OTUB2 Peptide - middle region

Catalog Number: BYT-ORB2009640
Article Name: OTUB2 Peptide - middle region
Biozol Catalog Number: BYT-ORB2009640
Supplier Catalog Number: orb2009640
Alternative Catalog Number: BYT-ORB2009640-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
Alternative Names: C14orf137, FLJ21916, MGC3102, OTB2, OTU2
OTUB2 Peptide - middle region
Molecular Weight: 27kDa
NCBI: 075601
UniProt: Q96DC9
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: EEHKFRNFFNAFYSVVELVEKDGSVSSLLKVFNDQSASDHIVQFLRLLTS
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with OTUB2 Rabbit Polyclonal Antibody (orb331030). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings