OSTF1 Peptide - N-terminal region

Artikelnummer: BYT-ORB2009644
Artikelname: OSTF1 Peptide - N-terminal region
Artikelnummer: BYT-ORB2009644
Hersteller Artikelnummer: orb2009644
Alternativnummer: BYT-ORB2009644-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
Alternative Synonym: FLJ20559, OSF, SH3P2, bA235O14.1
OSTF1 Peptide - N-terminal region
Molekulargewicht: 24kDa
NCBI: 036515
UniProt: Q92882
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: DMSDTNWWKGTSKGRTGLIPSNYVAEQAESIDNPLHEAAKRGNLSWLREC
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with OSTF1 Rabbit Polyclonal Antibody (orb585099). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings