OSTF1 Peptide - N-terminal region

Product Overview

• Article Name: OSTF1 Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB2009644
• Supplier Catalog Number: orb2009644
• Alternative Catalog Number: BYT-ORB2009644-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: FLJ20559, OSF, SH3P2, bA235O14.1

Product Description

OSTF1 Peptide - N-terminal region

Product Properties

• Molecular Weight: 24kDa
• NCBI: 036515
• UniProt: Q92882
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: DMSDTNWWKGTSKGRTGLIPSNYVAEQAESIDNPLHEAAKRGNLSWLREC

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with OSTF1 Rabbit Polyclonal Antibody (orb585099). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings