OSCAR Peptide - C-terminal region

Artikelnummer: BYT-ORB2009647
Artikelname: OSCAR Peptide - C-terminal region
Artikelnummer: BYT-ORB2009647
Hersteller Artikelnummer: orb2009647
Alternativnummer: BYT-ORB2009647-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
Alternative Synonym: MGC33613, PIGR3
OSCAR Peptide - C-terminal region
Molekulargewicht: 29kDa
NCBI: 570127
UniProt: Q8IYS5
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: VISWEDSGSSDYTRGNLVRLGLAGLVLISLGALVTFDWRSQNRAPAGIRP
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with OSCAR Rabbit Polyclonal Antibody (orb331212). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings