OSCAR Peptide - C-terminal region

Catalog Number: BYT-ORB2009647
Article Name: OSCAR Peptide - C-terminal region
Biozol Catalog Number: BYT-ORB2009647
Supplier Catalog Number: orb2009647
Alternative Catalog Number: BYT-ORB2009647-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
Alternative Names: MGC33613, PIGR3
OSCAR Peptide - C-terminal region
Molecular Weight: 29kDa
NCBI: 570127
UniProt: Q8IYS5
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: VISWEDSGSSDYTRGNLVRLGLAGLVLISLGALVTFDWRSQNRAPAGIRP
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with OSCAR Rabbit Polyclonal Antibody (orb331212). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings