OSBPL1A Peptide - middle region

Artikelnummer: BYT-ORB2009649
Artikelname: OSBPL1A Peptide - middle region
Artikelnummer: BYT-ORB2009649
Hersteller Artikelnummer: orb2009649
Alternativnummer: BYT-ORB2009649-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
Alternative Synonym: FLJ10217, ORP-1, ORP1, OSBPL1B
OSBPL1A Peptide - middle region
Molekulargewicht: 108kDa
NCBI: 542164
UniProt: Q9BXW6
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: EGEHLGSRKHRMSEEKDCGGGDALSNGIKKHRTSLPSPMFSRNDFSIWSI
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with OSBPL1A Rabbit Polyclonal Antibody (orb325223). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings