OSBPL1A Peptide - middle region

Catalog Number: BYT-ORB2009649
Article Name: OSBPL1A Peptide - middle region
Biozol Catalog Number: BYT-ORB2009649
Supplier Catalog Number: orb2009649
Alternative Catalog Number: BYT-ORB2009649-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
Alternative Names: FLJ10217, ORP-1, ORP1, OSBPL1B
OSBPL1A Peptide - middle region
Molecular Weight: 108kDa
NCBI: 542164
UniProt: Q9BXW6
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: EGEHLGSRKHRMSEEKDCGGGDALSNGIKKHRTSLPSPMFSRNDFSIWSI
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with OSBPL1A Rabbit Polyclonal Antibody (orb325223). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings