SIRPA Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2081561
Artikelname: SIRPA Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2081561
Hersteller Artikelnummer: orb2081561
Alternativnummer: BYT-ORB2081561-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SIRPA
Konjugation: HRP
Alternative Synonym: BIT, MFR, P84, SIRP, MYD-1, SHPS1, CD172A, PTPNS1
SIRPA Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 52kDa
NCBI: 542970
UniProt: B2R6C3
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: QTSPQPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK