SIRPA Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2081561
Article Name: SIRPA Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2081561
Supplier Catalog Number: orb2081561
Alternative Catalog Number: BYT-ORB2081561-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SIRPA
Conjugation: HRP
Alternative Names: BIT, MFR, P84, SIRP, MYD-1, SHPS1, CD172A, PTPNS1
SIRPA Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 52kDa
NCBI: 542970
UniProt: B2R6C3
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: QTSPQPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK