IGF1R Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2081574
Artikelname: IGF1R Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2081574
Hersteller Artikelnummer: orb2081574
Alternativnummer: BYT-ORB2081574-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IF, IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IGF1R
Konjugation: FITC
Alternative Synonym: IGFR, CD221, IGFIR, JTK13
IGF1R Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 71kDa
NCBI: 000866
UniProt: P08069
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: DRHSGHKAENGPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC