IGF1R Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2081574
Article Name: IGF1R Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2081574
Supplier Catalog Number: orb2081574
Alternative Catalog Number: BYT-ORB2081574-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IF, IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IGF1R
Conjugation: FITC
Alternative Names: IGFR, CD221, IGFIR, JTK13
IGF1R Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 71kDa
NCBI: 000866
UniProt: P08069
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: DRHSGHKAENGPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC